Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IPP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IPP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IPP Polyclonal specifically detects IPP in Human samples. It is validated for Western Blot.Specifications
IPP | |
Polyclonal | |
Rabbit | |
Q9Y573 | |
3652 | |
Synthetic peptides corresponding to IPP(intracisternal A particle-promoted polypeptide) The peptide sequence was selected from the C terminal of IPP (NP_005888). Peptide sequence EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
actin-binding protein IPP, intracisternal A particle-promoted polypeptideKLHL27Kelch-like protein 27 | |
IPP | |
IgG | |
65 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title