Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IPP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | IPP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156903
|
Novus Biologicals
NBP156903 |
100 μL |
Each for $436.00
|
|
NBP15690320
|
Novus Biologicals
NBP15690320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
IPP Polyclonal specifically detects IPP in Human samples. It is validated for Western Blot.Specifications
IPP | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
actin-binding protein IPP, intracisternal A particle-promoted polypeptideKLHL27Kelch-like protein 27 | |
IPP | |
IgG | |
Affinity Purified | |
65 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9Y573 | |
3652 | |
Synthetic peptides corresponding to IPP(intracisternal A particle-promoted polypeptide) The peptide sequence was selected from the C terminal of IPP (NP_005888). Peptide sequence EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title