Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IQCD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IQCD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IQCD Polyclonal specifically detects IQCD in Human samples. It is validated for Western Blot.Specifications
IQCD | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
115811 | |
Synthetic peptides corresponding to IQCD (IQ motif containing D) The peptide sequence was selected from the middle region of IQCD. Peptide sequence CLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSSLSPLMQQIKDSTKNVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
4933433C09Rik, IQ domain-containing protein D, IQ motif containing D | |
IQCD | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title