IQSEC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18148025UL

Catalog No. NB433862

Description

IQSEC1 Polyclonal specifically detects IQSEC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IQSEC1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Accession No.: Q6DN90
• Gene Symbols: IQSEC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAE
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ADP-ribosylation factors guanine nucleotide-exchange protein 100, ADP-ribosylation factors guanine nucleotide-exchange protein 2, ARFGEP100, BRAG2, IQ motif and Sec7 domain 1, IQ motif and SEC7 domain-containing protein 1, KIAA0763Brefeldin-resistant Arf-GEF 2 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9922
• Target Species: Human
• Isotype: IgG

For Research Use Only