Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Irisin/FNDC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
$416.50 - $670.00
Specifications
Antigen | Irisin/FNDC5 |
---|---|
Dilution | Western Blot, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50, Immunofluorescence Reported in scientific literature (PMID:31614634). |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Irisin/FNDC5 Polyclonal specifically detects Irisin/FNDC5 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence.Specifications
Irisin/FNDC5 | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
252995 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50, Immunofluorescence Reported in scientific literature (PMID:31614634). | |
Polyclonal | |
Rabbit | |
Human | |
fibronectin type III domain containing 5, fibronectin type III domain-containing protein 5, FRCP2Fibronectin type III repeat-containing protein 2 | |
FNDC5 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title