IRS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25621125UL

Catalog No. NB403762

Description

IRS2 Polyclonal specifically detects IRS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: IRS2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: insulin receptor substrate 2, IRS-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: IRS2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQAS
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Lipid and Metabolism, Nutrient Sensing in the Brain, Signal Transduction
• Gene ID (Entrez): 8660
• Target Species: Human
• Isotype: IgG

For Research Use Only