Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IRX6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180245
Description
IRX6 Polyclonal specifically detects IRX6 in Mouse samples. It is validated for Western Blot.Specifications
IRX6 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
iroquois homeobox 6, Iroquois homeobox protein 6Homeodomain protein IRXB3, iroquois homeobox protein 7, iroquois-class homeodomain protein IRX-6, IRX-3, IRX7IRXB3 | |
Rabbit | |
48 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_071873 | |
IRX6 | |
Synthetic peptide directed towards the C terminal of mouse IRX6. Peptide sequence RAQSPECHMIPRQPSSIRRLLVPRDSEGEEDSPAAKAFGNSTFTLQGLPL. | |
Protein A purified | |
RUO | |
79190 | |
Mouse, Rat | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction