IRX6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180245

Catalog No. NBP180245

Description

IRX6 Polyclonal specifically detects IRX6 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: IRX6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: iroquois homeobox 6, Iroquois homeobox protein 6Homeodomain protein IRXB3, iroquois homeobox protein 7, iroquois-class homeodomain protein IRX-6, IRX-3, IRX7IRXB3
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_071873
• Gene Symbols: IRX6
• Immunogen: Synthetic peptide directed towards the C terminal of mouse IRX6. Peptide sequence RAQSPECHMIPRQPSSIRRLLVPRDSEGEEDSPAAKAFGNSTFTLQGLPL.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79190
• Target Species: Mouse, Rat
• Form: Purified