Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ISCU Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238420
Description
ISCU Polyclonal specifically detects ISCU in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
ISCU | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Q9H1K1 | |
ISCU | |
This antibody was developed against a recombinant protein corresponding to amino acids: TFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPK | |
0.1 mL | |
Proteases & Other Enzymes | |
23479 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2310020H20Rik, HML, hnifU, iron-sulfur cluster assembly enzyme ISCU, mitochondrial, iron-sulfur cluster scaffold homolog (E. coli), IscU, IscU iron-sulfur cluster scaffold homolog, IscU iron-sulfur cluster scaffold homolog (E. coli), ISU2, MGC74517, NIFU, NifU-like N-terminal domain containing, NifU-like N-terminal domain-containing protein, NifU-like protein, NIFUN | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction