Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Isocitrate Dehydrogenase 1/IDH1 Antibody (CL0219), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP25288225UL
Description
Isocitrate Dehydrogenase 1/IDH1 Monoclonal antibody specifically detects Isocitrate Dehydrogenase 1/IDH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDownSpecifications
Isocitrate Dehydrogenase 1/IDH1 | |
Monoclonal | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Mouse | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
CL0219 | |
Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated | |
Cytosolic NADP-isocitrate dehydrogenase, EC 1.1.1.42, IDCD, IDH, IDP, IDPC, isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), soluble, NADP(+)-specific ICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, Oxalosuccinate decarboxylase, PICD | |
This antibody was developed against a recombinant protein corresponding to amino acids: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY | |
25 μL | |
Stem Cell Markers | |
3417 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG2a |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction