Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ISPD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | ISPD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17972220
![]() |
Novus Biologicals
NBP17972220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179722
![]() |
Novus Biologicals
NBP179722 |
100 μL |
Each for $487.50
|
|
|||||
Description
ISPD Polyclonal specifically detects ISPD in Human samples. It is validated for Western Blot.Specifications
ISPD | |
Polyclonal | |
Rabbit | |
Human | |
4-diphosphocytidyl-2C-methyl-D-erythritol synthase homolog, isoprenoid synthase domain containing, isoprenoid synthase domain-containing protein | |
ISPD | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
NP_001094887 | |
729920 | |
Synthetic peptide directed towards the N terminal of human hCG_1745121. Peptide sequence MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title