Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ISX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17921620UL
Description
ISX Polyclonal specifically detects ISX in Human samples. It is validated for Western Blot.Specifications
ISX | |
Polyclonal | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
intestine-specific homeobox, RAXLX | |
Rabbit | |
Affinity Purified | |
RUO | |
91464 | |
Human | |
IgG |
Western Blot | |
LYOPH | |
Western Blot 1:1000 | |
NP_001008494 | |
ISX | |
Synthetic peptide directed towards the N terminal of human ISXThe immunogen for this antibody is ISX. Peptide sequence ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV. | |
20 μL | |
Primary | |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction