Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ITCH/AIP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
Antigen | ITCH/AIP4 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ITCH/AIP4 Polyclonal specifically detects ITCH/AIP4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ITCH/AIP4 | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
83737 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
AIF4, AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)), atrophin-1 interacting protein 4, Atrophin-1-interacting protein 4, dJ468O1.1, EC 6.3.2, EC 6.3.2.-, Itch, itchy (mouse homolog) E3 ubiquitin protein ligase, itchy E3 ubiquitin protein ligase homolog (mouse), itchy homolog E3 ubiquitin protein ligase, NAPP1E3 ubiquitin-protein ligase Itchy homolog, NFE2-associated polypeptide 1, ubiquitin protein ligase ITCH | |
ITCH | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title