ITGB1BP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP255685	Novus Biologicals NBP255685	100 μL
NB394875	Novus Biologicals NBP25568525UL	25 μL

Description

ITGB1BP3 Polyclonal specifically detects ITGB1BP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ITGB1BP3
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, Cytokine Research, Cytoskeleton Markers, Embryonic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Signal Transduction, Stem Cell Markers
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 27231
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside kinase 2, NmR-K 2, NRK2RNK 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2
• Gene Symbols: NMRK2
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only