Invitrogen™ ITLN1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579543

Catalog No. PIPA579543

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: SW620 whole cell. IHC: human intestinal cancer tissue. ICC/IF: U20S cell. Flow: U937 cell.

ITLN1 has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. ITLN1 increases AKT phosphorylation in the absence and presence of insulin. ITLN1 may play a role in the defense system against microorganisms. ITLN1 may specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. ITLN1 may be involved in iron metabolism.

Specifications

• Antigen: ITLN1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ITLN1
• Gene Alias: calcium-dependent galactosyl-specific lectin; endothelial lectin HL-1; FLJ20022; Galactofuranose-binding lectin; hIntL; HL1; HL-1; intelectin 1; intelectin 1 (galactofuranose binding); intelectin 1 (galactofuranose binding)-like; intelectin 2; intelectin 5; intelectin a; intelectin-1; Intelectin-1a; intestinal lactoferrin receptor; INTL; Itln; ITLN1; ITLN-1; Itln1a; Itln2; Itln5; Itlna; LFR; omentin; UNQ640/PRO1270
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 55600
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q8WWA0
• Gene Symbols: ITLN1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov