Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ITPK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ITPK1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ITPK1 Polyclonal specifically detects ITPK1 in Human samples. It is validated for Western Blot.Specifications
| ITPK1 | |
| Polyclonal | |
| Rabbit | |
| Q13572 | |
| 3705 | |
| Synthetic peptides corresponding to ITPK1(inositol 1,3,4-triphosphate 5/6 kinase) The peptide sequence was selected from the N terminal of ITPK1. Peptide sequence MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.7.1.134, EC 2.7.1.159, inositol 13,4-triphosphate 5/6 kinase, inositol 13,4-trisphosphate 5/6 kinase, Inositol 13,4-trisphosphate 5/6-kinase, inositol-tetrakisphosphate 1-kinase, Inositol-triphosphate 5/6-kinase, Ins(13,4)P(3) 5/6-kinase, ITRPK1 | |
| ITPK1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title