Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Jagged 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
$382.00 - $646.00
Specifications
| Antigen | Jagged 2 |
|---|---|
| Concentration | 0.05mg/mL |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunohistochemistry-Frozen |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classification | Polyclonal |
Description
Jagged 2 Polyclonal specifically detects Jagged 2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| Jagged 2 | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunohistochemistry-Frozen | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3714 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.05mg/mL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| RUO | |
| HJ2, jagged 2, Jagged2, protein jagged-2, SER2 | |
| JAG2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Jagged 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title