Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JMJD2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | JMJD2B |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
JMJD2B Polyclonal specifically detects JMJD2B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| JMJD2B | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 1.14.11, FLJ44906, JHDM3B, JmjC domain-containing histone demethylation protein 3B, JMJD2BEC 1.14.11.-, jumonji domain containing 2B, Jumonji domain-containing protein 2B, KIAA0876lysine-specific demethylase 4B, lysine (K)-specific demethylase 4B | |
| KDM4B | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| Chromatin Modifiers, Chromatin Research, Epigenetics | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 23030 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title