Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JMJD2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP247413
Description
JMJD2D Polyclonal specifically detects JMJD2D in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
JMJD2D | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10 - 1:20 | |
EC 1.14.11, EC 1.14.11.-, FLJ10251, JHDM3D, JmjC domain-containing histone demethylation protein 3D, JMJD2Dlysine-specific demethylase 4D, jumonji domain containing 2D, Jumonji domain-containing protein 2D, lysine (K)-specific demethylase 4D, MGC141909 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KDM4D | |
This antibody was developed against a recombinant protein corresponding to amino acids: LRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSN | |
0.1 mL | |
Transcription Factors and Regulators | |
55693 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction