Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JOSD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | JOSD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15670920
|
Novus Biologicals
NBP15670920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156709
|
Novus Biologicals
NBP156709 |
100 μL |
Each for $487.50
|
|
|||||
Description
JOSD2 Polyclonal specifically detects JOSD2 in Human samples. It is validated for Western Blot.Specifications
| JOSD2 | |
| Polyclonal | |
| Rabbit | |
| Q8TAC2 | |
| 126119 | |
| Synthetic peptides corresponding to JOSD2(Josephin domain containing 2) The peptide sequence was selected from the N terminal of JOSD2. Peptide sequence QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.19.12, FLJ29018, Josephin domain containing 2, Josephin domain-containing protein 2, Josephin-2, SBBI54 | |
| JOSD2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title