Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

JOSD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen JOSD2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15670920
View Documents
Novus Biologicals
NBP15670920UL
20 μL
Each for $152.22
Add to cart
 
NBP156709
View Documents
Novus Biologicals
NBP156709
100 μL
Each for $436.00
Add to cart
 
Description

Description

JOSD2 Polyclonal specifically detects JOSD2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

JOSD2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 3.4.19.12, FLJ29018, Josephin domain containing 2, Josephin domain-containing protein 2, Josephin-2, SBBI54
JOSD2
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q8TAC2
126119
Synthetic peptides corresponding to JOSD2(Josephin domain containing 2) The peptide sequence was selected from the N terminal of JOSD2. Peptide sequence QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit