Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Jumonji/JARID2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25701925UL
Description
Jumonji/JARID2 Polyclonal specifically detects Jumonji/JARID2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Jumonji/JARID2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
JMJjumonji-like protein, jumonji (mouse) homolog, jumonji homolog, jumonji, AT rich interactive domain 2, Jumonji/ARID domain-containing protein 2, protein Jumonji | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
JARID2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR | |
25 μL | |
Chromatin Modifiers, Chromatin Research, Epigenetics, Neuroscience, Transcription Factors and Regulators | |
3720 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction