Kallikrein 4/Prostase/EMSP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438044	Novus Biologicals NBP21417125UL	25ul
NBP214171	Novus Biologicals NBP214171	0.1 mL

Description

Kallikrein 4/Prostase/EMSP1 Polyclonal specifically detects Kallikrein 4/Prostase/EMSP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kallikrein 4/Prostase/EMSP1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: AI2A1, ARM1, EC 3.4.21, EC 3.4.21.-, EMSP, EMSP1MGC116827, Enamel matrix serine proteinase 1, kallikrein 4 (prostase, enamel matrix, prostate), kallikrein-4, Kallikrein-like protein 1, kallikrein-related peptidase 4, KLK-L1MGC116828, Prostase, PRSS17enamel matrix serine protease 1, PSTSandrogen-regulated message 1, Serine protease 17
• Gene Symbols: KLK4
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 9622
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYH
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only