Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Kanadaptin Antibody, Novus Biologicals™

Kanadaptin Antibody, Novus Biologicals™
SDP

Catalog No. NB436246 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436246 25 μL
NBP238315 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436246 Supplier Novus Biologicals Supplier No. NBP23831525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Kanadaptin Polyclonal specifically detects Kanadaptin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Kanadaptin
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9BWU0
Gene Alias FLJ10624, FLJ41004, HLC3, HLC-3, Human lung cancer oncogene 3 protein, kanadaptin, Kidney anion exchanger adapter protein, kidney anion exchanger adaptor protein, lung cancer oncogene 3, MGC120646, MGC120648, solute carrier family 4 (anion exchanger), member 1, adapter protein, solute carrier family 4 (anion exchanger), member 1, adaptor protein, Solute carrier family 4 anion exchanger member 1 adapter protein
Gene Symbols SLC4A1AP
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22950
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.