Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KANK3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | KANK3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156366
|
Novus Biologicals
NBP156366 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
KANK3 Polyclonal specifically detects KANK3 in Human samples. It is validated for Western Blot.Specifications
KANK3 | |
Polyclonal | |
Rabbit | |
Q6NY19-2 | |
256949 | |
Synthetic peptides corresponding to ANKRD47 The peptide sequence was selected from the N terminal of ANKRD47. Peptide sequence GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ANKRD47, ankyrin repeat domain 47, Ankyrin repeat domain-containing protein 47, FLJ46061, kidney ankyrin repeat-containing protein 3, KN motif and ankyrin repeat domain-containing protein 3, KN motif and ankyrin repeat domains 3 | |
KANK3 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title