Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kaptin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Kaptin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Kaptin Polyclonal specifically detects Kaptin in Human samples. It is validated for Western Blot.Specifications
Kaptin | |
Polyclonal | |
Rabbit | |
Q9Y664 | |
11133 | |
Synthetic peptides corresponding to KPTN(kaptin (actin binding protein)) The peptide sequence was selected from the N terminal of KPTN. Peptide sequence MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
2E4, Actin-associated protein 2E4, kaptin, kaptin (actin binding protein), kaptin (actin-binding protein) | |
KPTN | |
IgG | |
47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title