Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Karyopherin (importin) beta 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Karyopherin (importin) beta 3 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Karyopherin (importin) beta 3 Polyclonal specifically detects Karyopherin (importin) beta 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Karyopherin (importin) beta 3 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DKFZp686O1576, FLJ43041, IMB3, imp5, importin 5, importin beta-3 subunit, Importin subunit beta-3, importin-5, karyopherin (importin) beta 3, Karyopherin beta-3, KPNB3, MGC2068, RAN binding protein 5, Ran_GTP binding protein 5, Ran-binding protein 5, RANBP5 | |
IPO5 | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Human | |
O00410 | |
3843 | |
This antibody was developed against a recombinant protein corresponding to amino acids: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title