Katanin p60 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189491

Catalog No. NBP189491

Description

Katanin p60 Polyclonal specifically detects Katanin p60 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Katanin p60
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.6.4.3, katanin p60 (ATPase containing) subunit A 1, katanin p60 (ATPase-containing) subunit A 1, katanin p60 ATPase-containing subunit A1, Katanin p60 subunit A1, p60 katanin
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.1mg/mL
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: O75449
• Gene Symbols: KATNA1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDD
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11104
• Target Species: Human
• Isotype: IgG

For Research Use Only