KCC4/SLC12A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP185133

Catalog No. NBP185133

Description

KCC4/SLC12A7 Polyclonal specifically detects KCC4/SLC12A7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KCC4/SLC12A7
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: DKFZp434F076, KCC4Electroneutral potassium-chloride cotransporter 4, K-Cl cotransporter 4, potassium/chloride transporter KCC4, solute carrier family 12 (potassium/chloride transporters), member 7, solute carrier family 12 member 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10723
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC12A7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human KCC4/SLC12A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only