Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KCNB1 Antibody, Novus Biologicals™

KCNB1 Antibody, Novus Biologicals™
SDP

Catalog No. NB436190 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436190 25 μL
NBP238498 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436190 Supplier Novus Biologicals Supplier No. NBP23849825UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

KCNB1 Polyclonal specifically detects KCNB1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen KCNB1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q14721
Gene Alias Delayed rectifier potassium channel 1, delayed rectifier potassium channel Kv2.1, DRK1, h-DRK1, h-DRK1 K(+) channel, Kv2.1, potassium channel protein DRK1, potassium voltage-gated channel subfamily B member 1, potassium voltage-gated channel, Shab-related subfamily, member 1, Voltage-gated potassium channel subunit Kv2.1
Gene Symbols KCNB1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ECATLLDKAVLSPESSIYTTASAKTPPRSPEKHTAIAFNFEAGVHQYIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPTSPKFLRQNCIYSTEALTGK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3745
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.