Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCNE1-like Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18583525UL
Description
KCNE1-like Polyclonal specifically detects KCNE1-like in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
KCNE1-like | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
AMME syndrome candidate gene 2 protein, AMMECR2, AMMECR2 protein, cardiac voltage-gated potassium channel accessory subunit 5, KCNE1-like, KCNE5, potassium voltage-gated channel subfamily E member 1-like protein, potassium voltage-gated channel, Isk-related family, member 1-like | |
Rabbit | |
Affinity Purified | |
RUO | |
23630 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KCNE1L | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDA | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction