Invitrogen™ KCNH1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595492

Catalog No. PIPA595492

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human COLO-320 cell, human HepG2 cell, human A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH1 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH1 is activated at the onset of myoblast differentiation. KCNH1 is highly expressed in brain and in myoblasts. Overexpression of KCNH1 may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of KCNH1 results in two transcript variants encoding distinct isoforms.

Specifications

• Antigen: KCNH1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: KCNH1
• Gene Alias: EAG; EAG channel 1; EAG1; ether a go-go; ether-a-go-go potassium channel 1; ether-a-go-go, Drosophila, homolog of; h-eag; hEAG1; Kcnh1; Kv10.1; M-eag; potassium channel, voltage gated eag related subfamily H, member 1; potassium voltage-gated channel subfamily H member 1; potassium voltage-gated channel, subfamily H (eag-related), member 1; r-eag; TMBTS; voltage-gated potassium channel subunit Kv10.1; ZLS1
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 16510, 3756, 65198
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4 mg trehalose and 0.05 mg sodium azide
• Gene Accession No.: O95259, Q60603, Q63472
• Gene Symbols: KCNH1
• Immunogen: A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG