KCNK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169621

Catalog No. NBP169621

Description

KCNK4 Polyclonal specifically detects KCNK4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KCNK4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: K2p4.1, K2P4.1 potassium channel, potassium channel subfamily K member 4, potassium channel, subfamily K, member 4, TRAAKTRAAK1, TWIK-related arachidonic acid-stimulated potassium channel protein, Two pore K(+) channel KT4.1, two pore K+ channel KT4.1, Two pore potassium channel KT4.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%; Equine: 86%; Bovine: 86%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NYG8
• Gene Symbols: KCNK4
• Immunogen: Synthetic peptides corresponding to KCNK4(potassium channel, subfamily K, member 4) The peptide sequence was selected from the N terminal of KCNK4. Peptide sequence ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 50801
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only