Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCNMB4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25658325UL
Description
KCNMB4 Polyclonal specifically detects KCNMB4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
KCNMB4 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
BK channel subunit beta-4, BKbeta4, calcium-activated potassium channel subunit beta-4, Calcium-activated potassium channel, subfamily M subunit beta-4, Charybdotoxin receptor subunit beta-4, hbeta4, K(VCA)beta-4, large conductance calcium-dependent potassium ion channel beta 4 subunit, Maxi K channel subunit beta-4, potassium large conductance calcium-activated channel, subfamily M, beta member4, slo-beta-4 | |
Rabbit | |
Affinity Purified | |
RUO | |
27345 | |
Human | |
Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
KCNMB4 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction