Learn More
Description
Specifications
Specifications
| Antigen | KCNN4 |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | hIKCa1, hKCa4, hSK4, IK1, IKCa1, intermediate conductance calcium-activated potassium channel protein 4, KCa3.1IKCA1, KCa4, KCA4SKCa4, potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 4, putative erythrocyte intermediate conductance calcium-activated potassiumGardos channel, Putative Gardos channel, SK4SKCa 4 |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein KCNN4 using the following amino acid sequence: LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
