KCNN4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB436786	Novus Biologicals NBP23369425UL	25 μL
NBP233694	Novus Biologicals NBP233694	0.1 mL

Description

KCNN4 Polyclonal specifically detects KCNN4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KCNN4
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: hIKCa1, hKCa4, hSK4, IK1, IKCa1, intermediate conductance calcium-activated potassium channel protein 4, KCa3.1IKCA1, KCa4, KCA4SKCa4, potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 4, putative erythrocyte intermediate conductance calcium-activated potassiumGardos channel, Putative Gardos channel, SK4SKCa 4
• Gene Symbols: KCNN4
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: O15554
• Gene ID (Entrez): 3783
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only