Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCTD16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KCTD16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KCTD16 Polyclonal specifically detects KCTD16 in Human samples. It is validated for Western Blot.Specifications
KCTD16 | |
Polyclonal | |
Rabbit | |
Q68DU8 | |
57528 | |
Synthetic peptides corresponding to KCTD16 (potassium channel tetramerisation domain containing 16) The peptide sequence was selected from the N terminal of KCTD16. Peptide sequence KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BTB/POZ domain-containing protein KCTD16, DKFZp781A1155, KIAA1317Potassium channel tetramerization domain-containing protein 16, MGC138167, potassium channel tetramerisation domain containing 16 | |
KCTD16 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title