Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCTD16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | KCTD16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KCTD16 Polyclonal specifically detects KCTD16 in Human samples. It is validated for Western Blot.Specifications
| KCTD16 | |
| Polyclonal | |
| Rabbit | |
| Q68DU8 | |
| 57528 | |
| Synthetic peptides corresponding to KCTD16 (potassium channel tetramerisation domain containing 16) The peptide sequence was selected from the N terminal of KCTD16. Peptide sequence KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BTB/POZ domain-containing protein KCTD16, DKFZp781A1155, KIAA1317Potassium channel tetramerization domain-containing protein 16, MGC138167, potassium channel tetramerisation domain containing 16 | |
| KCTD16 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title