KCTD18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180093

Catalog No. NBP180093

Description

KCTD18 Polyclonal specifically detects KCTD18 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KCTD18
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BTB/POZ domain-containing protein KCTD18, FLJ31322, FLJ37818, potassium channel tetramerisation domain containing 18,6530404F10Rik
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 130535
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689600
• Gene Symbols: KCTD18
• Immunogen: Synthetic peptide directed towards the N terminal of human KCTD18. Peptide sequence LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 92%; Equine: 92%; Mouse: 92%; Rat: 92%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Form: Purified