Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCTD18 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18009320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18009320 20 μL
NBP180093 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18009320 Supplier Novus Biologicals Supplier No. NBP18009320UL

Rabbit Polyclonal Antibody

KCTD18 Polyclonal specifically detects KCTD18 in Human samples. It is validated for Western Blot.

Specifications

Antigen KCTD18
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_689600
Gene Alias BTB/POZ domain-containing protein KCTD18, FLJ31322, FLJ37818, potassium channel tetramerisation domain containing 18,6530404F10Rik
Gene Symbols KCTD18
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human KCTD18. Peptide sequence LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 130535
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.