Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCTD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309612100UL

 View more versions of this product

Catalog No. NB124125


Only null left
Add to Cart

Description

Description

KCTD2 Polyclonal specifically detects KCTD2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

KCTD2
Polyclonal
Western Blot 1.0 ug/ml
BTB/POZ domain-containing protein KCTD2, potassium channel tetramerisation domain containing 2
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCTD2 (NP_056168). Peptide sequence LVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQ
100 μg
Primary
Human
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
23510
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.