Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCTD21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KCTD21 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KCTD21 Polyclonal specifically detects KCTD21 in Human samples. It is validated for Western Blot.Specifications
KCTD21 | |
Polyclonal | |
Rabbit | |
NP_001025030 | |
283219 | |
Synthetic peptide directed towards the N terminal of human KCTD21The immunogen for this antibody is KCTD21. Peptide sequence RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BTB/POZ domain-containing protein KCTD21, KCASH2, potassium channel tetramerisation domain containing 21 | |
KCTD21 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title