Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCTD9 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157662

 View more versions of this product

Catalog No. NBP157662


Only null left
Add to Cart

Description

Description

KCTD9 Polyclonal specifically detects KCTD9 in Human samples. It is validated for Western Blot.
Specifications

Specifications

KCTD9
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
BTB/POZ domain-containing protein KCTD9, FLJ20038, potassium channel tetramerisation domain containing 9
Rabbit
Affinity purified
RUO
54793
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q7L273
KCTD9
Synthetic peptides corresponding to KCTD9 (potassium channel tetramerisation domain containing 9) The peptide sequence was selected from the middle region of KCTD9. Peptide sequence AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG.
100 μL
Primary
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.