Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCTD9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | KCTD9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15766220
|
Novus Biologicals
NBP15766220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157662
|
Novus Biologicals
NBP157662 |
100 μL |
Each for $487.50
|
|
|||||
Description
KCTD9 Polyclonal specifically detects KCTD9 in Human samples. It is validated for Western Blot.Specifications
| KCTD9 | |
| Polyclonal | |
| Rabbit | |
| Q7L273 | |
| 54793 | |
| Synthetic peptides corresponding to KCTD9 (potassium channel tetramerisation domain containing 9) The peptide sequence was selected from the middle region of KCTD9. Peptide sequence AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BTB/POZ domain-containing protein KCTD9, FLJ20038, potassium channel tetramerisation domain containing 9 | |
| KCTD9 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title