Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCTD9 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen KCTD9
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15766220
SDP
View Documents
Novus Biologicals
NBP15766220UL
20 μL
Each for $206.00
Only null left
Add to Cart
 
NBP157662
SDP
View Documents
Novus Biologicals
NBP157662
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

KCTD9 Polyclonal specifically detects KCTD9 in Human samples. It is validated for Western Blot.
Specifications

Specifications

KCTD9
Polyclonal
Rabbit
Q7L273
54793
Synthetic peptides corresponding to KCTD9 (potassium channel tetramerisation domain containing 9) The peptide sequence was selected from the middle region of KCTD9. Peptide sequence AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG.
Primary
Western Blot
Unconjugated
RUO
BTB/POZ domain-containing protein KCTD9, FLJ20038, potassium channel tetramerisation domain containing 9
KCTD9
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.