KDM2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180379

Catalog No. NBP180379

Description

KDM2B Polyclonal specifically detects KDM2B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KDM2B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: [Histone-H3]-lysine-36 demethylase 1B, CXXC2F-box protein FBL10, CXXC-type zinc finger protein 2, Fbl10, F-box and leucine-rich repeat protein 10JEMMA (Jumonji domain, EMSY-interactor, methyltransferase motif) protein, FBXL10, JHDM1BF-box/LRR-repeat protein 10, JmjC domain-containing histone demethylation protein 1B, jumonji C domain-containing histone demethylase 1B, Jumonji domain-containing EMSY-interactor methyltransferase motif protein, lysine (K)-specific demethylase 2B, lysine-specific demethylase 2B, PCCX2EC 1.14.11.27, protein containing CXXC domain 2, Protein JEMMA, Protein-containing CXXC domain 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 153 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Rat: 100%; Canine: 100%; Chicken: 100%; Bovine: 100%; Xenopus: 85%; Western clawed frog: 85%; Zebrafish: 78%; Green puffer: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NHM5
• Gene Symbols: KDM2B
• Immunogen: Synthetic peptide directed towards the middle region of human FBXL10 (NP_115979). Peptide sequence LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84678
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only