Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP180379

KDM2B Antibody, Novus Biologicals™
SDP

Catalog No. NBP180379 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180379 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180379 Supplier Novus Biologicals Supplier No. NBP180379
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

KDM2B Polyclonal specifically detects KDM2B in Human samples. It is validated for Western Blot.

Specifications

Antigen KDM2B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8NHM5
Gene Alias [Histone-H3]-lysine-36 demethylase 1B, CXXC2F-box protein FBL10, CXXC-type zinc finger protein 2, Fbl10, F-box and leucine-rich repeat protein 10JEMMA (Jumonji domain, EMSY-interactor, methyltransferase motif) protein, FBXL10, JHDM1BF-box/LRR-repeat protein 10, JmjC domain-containing histone demethylation protein 1B, jumonji C domain-containing histone demethylase 1B, Jumonji domain-containing EMSY-interactor methyltransferase motif protein, lysine (K)-specific demethylase 2B, lysine-specific demethylase 2B, PCCX2EC 1.14.11.27, protein containing CXXC domain 2, Protein JEMMA, Protein-containing CXXC domain 2
Gene Symbols KDM2B
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human FBXL10 (NP_115979). Peptide sequence LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL.
Molecular Weight of Antigen 153 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84678
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Rat: 100%; Canine: 100%; Chicken: 100%; Bovine: 100%; Xenopus: 85%; Western clawed frog: 85%; Zebrafish: 78%; Green puffer: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.