Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KDM6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
Supplier: Novus Biologicals NBP180628
Description
KDM6A Polyclonal specifically detects KDM6A in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
KDM6A | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 32071397)., Immunohistochemistry-Paraffin 1:200 - 1:500 | |
bA386N14.2, bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX)), DKFZp686A03225, EC 1.14.11, EC 1.14.11.-, Histone demethylase UTX, lysine (K)-specific demethylase 6A, MGC141941, ubiquitously transcribed tetratricopeptide repeat protein X-linked, ubiquitously transcribed tetratricopeptide repeat, X chromosome, ubiquitously transcribed TPR protein on the X chromosome, ubiquitously transcribed X chromosome tetratricopeptide repeat protein, ubiquitously-transcribed TPR gene on the X chromosome, Ubiquitously-transcribed TPR protein on the X chromosome, Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein, UTXlysine-specific demethylase 6A | |
Rabbit | |
Affinity Purified | |
RUO | |
7403 | |
Human, Mouse | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KDM6A | |
This antibody was developed against Recombinant Protein corresponding to amino acids:IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT | |
0.1 mL | |
Primary | |
Specificity of human KDM6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction