Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KDM6A Antibody, Novus Biologicals™
SDP

Catalog No. NBP180628 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180628 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180628 Supplier Novus Biologicals Supplier No. NBP180628
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 3 publications

KDM6A Polyclonal specifically detects KDM6A in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen KDM6A
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 32071397)., Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias bA386N14.2, bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX)), DKFZp686A03225, EC 1.14.11, EC 1.14.11.-, Histone demethylase UTX, lysine (K)-specific demethylase 6A, MGC141941, ubiquitously transcribed tetratricopeptide repeat protein X-linked, ubiquitously transcribed tetratricopeptide repeat, X chromosome, ubiquitously transcribed TPR protein on the X chromosome, ubiquitously transcribed X chromosome tetratricopeptide repeat protein, ubiquitously-transcribed TPR gene on the X chromosome, Ubiquitously-transcribed TPR protein on the X chromosome, Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein, UTXlysine-specific demethylase 6A
Gene Symbols KDM6A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7403
Test Specificity Specificity of human KDM6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.