Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIAA0040 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	KIAA0040
Dilution	Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259798 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP259798	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393130 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25979825UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

KIAA0040 Polyclonal specifically detects KIAA0040 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	KIAA0040
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	FLJ75822, hypothetical protein LOC9674, KIAA0040, MGC133301
Gene Symbols	KIAA0040
Isotype	IgG
Purification Method	Protein A purified

Dilution	Immunohistochemistry-Paraffin 1:200 - 1:500
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	9674
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acid sequence:MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIH
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only (RUO)

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

KIAA0040 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents