Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317874100UL
This item is not returnable.
View return policy
Description
KIF15 Polyclonal antibody specifically detects KIF15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
KIF15 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
FLJ25667, HKLP2, kinesin family member 15, kinesin-like 7, Kinesin-like protein 2, Kinesin-like protein 7, kinesin-like protein KIF15, KLP2, KNSL7, NY-BR-62, Serologically defined breast cancer antigen NY-BR-62 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVD | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
56992 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction