Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF16B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP21415725UL
Description
KIF16B Polyclonal specifically detects KIF16B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
KIF16B | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
C20orf23, chromosome 20 open reading frame 23, dJ971B4.1, FLJ20135, KIAA1590, kinesin family member 16B, kinesin-like protein KIF16B, KISC20ORF, SNX23kinesin motor protein, sorting nexin 23, Sorting nexin-23 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KIF16B | |
This antibody was developed against a recombinant protein corresponding to the amino acids: KLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEYRLQYKERQLQYLLQNHLPTLLEEKQ | |
25ul | |
Signal Transduction | |
55614 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction