Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KIF1C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
KIF1C Polyclonal specifically detects KIF1C in Human samples. It is validated for Western Blot.Specifications
KIF1C | |
Polyclonal | |
Purified | |
RUO | |
O43896 | |
10749 | |
Synthetic peptides corresponding to KIF1C (kinesin family member 1C) The peptide sequence was selected from the C terminal of KIF1C. Peptide sequence GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
Immunology, Innate Immunity | |
KIAA0706, kinesin family member 1C, kinesin-like protein KIF1C, LTXS1 | |
KIF1C | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title