Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KIF3A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KIF3A Polyclonal specifically detects KIF3A in Human samples. It is validated for Western Blot.Specifications
KIF3A | |
Polyclonal | |
Rabbit | |
Q9Y496 | |
11127 | |
Synthetic peptides corresponding to KIF3A (kinesin family member 3A) The peptide sequence was selected from the C terminal of KIF3A. Peptide sequence PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIF3, kinesin family member 3A, kinesin family protein 3A, kinesin-like protein KIF3A, Microtubule plus end-directed kinesin motor 3A | |
KIF3A | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title