Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158138
Description
KIF3B Polyclonal specifically detects KIF3B in Human samples. It is validated for Western Blot.Specifications
KIF3B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
HH0048, KIAA0359Microtubule plus end-directed kinesin motor 3B, kinesin family member 3B, kinesin-like protein KIF3B | |
Rabbit | |
Affinity purified | |
RUO | |
9371 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O15066 | |
KIF3B | |
Synthetic peptides corresponding to KIF3B (kinesin family member 3B) The peptide sequence was selected from the C terminal of KIF3B. Peptide sequence APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Mouse: 91%; Rat: 91%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction