Kif4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256589

Catalog No. NBP256589

Description

Kif4A Polyclonal specifically detects Kif4A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Kif4A
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: chromokinesin-A, chromosome-associated kinesin KIF4A, FLJ12530, FLJ12655, FLJ14204, FLJ20631, HSA271784, KIF4G1, KIF4KIF4-G1, kinesin family member 4A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KIF4A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKE
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Lipid and Metabolism, Mitotic Regulators, Neuroscience, Stem Cell Markers
• Gene ID (Entrez): 24137
• Target Species: Human
• Isotype: IgG

For Research Use Only